Figures (1)  Tables (4)
    • Figure 1. 

      Spectrum of bioactivities demonstrated by numerous marine derived bioactive peptides.

    • Peptide sequenceBioactivity * (ACE inhibition IC50; μM)Reference
      Cuttlefish (Sepia officinalis) crude protease (from Bacillus mojavensis A21) hydrolysateAla-His-Ser-Tyr11.6[35]
      Gly-Asp-Ala-Pro22.5
      Ala-Gly-Ser-Pro37.2
      Asp-Phe-Gly44.7
      Cuttlefish (S. officinalis) muscles hepatopancreas enzyme hydrolysateAla-Phe-Val-Gly-Tyr-Val-Leu-Pro25.66[36]
      Glu-Lys-Ser-Tyr-Glu-Leu-Pro14.41
      Val-Glu-Leu-Tyr-Pro5.22 (non-competitive) and lowering of systolic blood pressure in spontaneously hypertensive rats (SHR)
      Lizard fish (Saurida elongata) muscle protease hydrolysateGly-Met-Lys-Cys-Ala-Phe45.7 ± 1.1[37]
      Arg-Val-Cys-Leu-Pro175 [38]
      Grass carp (Ctenopharyngodon idella) muscle alcalase hydrolysateVal-Ala-Pro18.6 (competitive)[39]
      Atlantic salmon (Salmo salar) skin collagen hydrolyzed by Alcalase followed by papainAla-Pro0.060 ± 0.001 mg/mL[40]
      Val-Arg0.332 ± 0.005 mg/mL
      Skipjack (Katsuwonus pelamis) roe alcalase hydrolysateAsp-Leu-Asp-Leu-Arg-Lys-Asp-Leu-Tyr-Ala-Asn67.4[33]
      Met-Cys-Tyr-Pro-Ala-Ser-Thr58.7
      Met-Leu-Val-Phe-Ala-Val3.07
      Ser-Pro0.06 ± 0.01 mg/mL[41]
      Val-Asp-Arg-Tyr-Phe0.28 ± 0.03 mg/mL
      Val-His-Gly-Val-Val0.90 ± 0.16 mg/mL
      Tyr-Glu0.80 ± 0.03 mg/mL
      Phe-Glu-Met2.18 ± 0.20 mg/mL
      Phe-Trp-Arg-Val0.76 ± 0.10 mg/mL
      Pacific cod (Gadus macrocephalus) skin gelatin pepsin hydrolysateGly-Ala-Ser-Ser-Gly-Met-Pro-Gly6.9[42]
      Leu-Ala-Tyr-Ala14.5
      Flounder fish (Paralichthys olivaceus)
      muscle pepsin
      Met-Glu-Val-Phe-Val-Pro79 (competitive)[43]
      Val-Ser-Gln-Leu-Arg-Thr105 (non-competitive)
      Haruan (Channa striatus) Thermolysin hydrolysateVal-Pro-Ala-Ala-Pro-Pro-Lys0.45[44]
      Asn-Gly-Thr-Trp-Phe-Glu-Pro-Pro0.63
      U. pinnatifida (wakame) peptide from hot water extractIle-Tyr, Phe-Tyr, Tyr-His, Lys-TyrRespective IC50 values are 2.7, 3.7, 5.1, 7.7[45]
      Jellyfish (Rhopilema esculentum) alcalase hydrolysateVal-Lys-Pro and Val-Lys-Cys-Phe-ArgRespective IC50 values are 1.3 and 34.5[46]
      Blue mussel (Mytilus edulis) protein hydrolyzatesIle-Lys, Tyr-Glu-Gly-Asp-Pro, Trp-Phe,
      and Ser-Trp-Ile-Ser-Ser
      Respective IC50 values are 0.77, 0.19, 0.40, and 0.32 mg/mL[47]
      in vitro gastrointestinal digest of Isochrysis zhanjiangensisGlu-Thr-Thr15.08 (non-competitive)[48]
      Sonicated Spirulina sp. protease K digestTVLYEH and LQAGGLF2.88 and 66.83 (competitive)[49]
      * The IC50 value of ACE inhibitory activity is given in the unit μM if not specified otherwise.

      Table 1. 

      ACE inhibitor peptides obtained from marine organisms.

    • Peptide sequenceBioactivityReference
      Jumbo squid (Dosidicus gigas) skin gelatin tryptic hydrolysateP1: Phe-Asp-Ser-Gly-Pro-Ala-Gly-Val-Leu
      P2: Asn-Gly-Pro-Leu-Gln-Ala-Gly-Gln-Pro-Gly-Glu-Arg
      Lipid peroxidation inhibition is higher than α-tocopherol. Hydroxyl radical scavenging IC50 = 90.90 (P1) and 100.72 μM (P2). Improve the viability of t-Butyl hydroperoxide-induced lung fibroblasts.[60]
      Alaska pollack skin gelatin serial hydrolyzed
      by Alcalase, Pronase E, and collagenase in
      a three-step recycling membrane reactor.
      Gly-Pro-Hyp-Gly-Pro-Hyp-Gly-Pro-Hyp-Gly-Pro-Hyp-GlyHigh antioxidant activity based on TBA assay. Increase viability in tertbutylhydroperoxide (t-BHP)-induced rat liver cells.[67]
      Giant squid (D. gigas) muscle protein ultrafiltrationAsn-Ala-Asp-Phe-Gly-Leu-Asn-Gly-Leu-Glu-Gly-Leu-AlaImprove the viability of cytotoxic embryonic lung fibroblasts by a significant margin at a concentration of 50 g/mL. Suppress radical-induced oxidation of membrane lipids. Radical scavenging activity carbon centered (IC50 396.04 μM), hydroxyl (IC50 497.32 μM), and superoxide radicals (IC50 669.34 μM).[65]
      Asn-Gly-Leu-Glu-Gly-Leu-LysSignificantly enhance the viability of cytotoxic embryonic lung fibroblasts at 50 μg/mL. Suppress radical-induced oxidation of membrane lipids. Radical scavenging activity carbon centered (IC50 396.04 μM), hydroxyl (IC50 497.32 μM), and superoxide radicals (IC50 669.34 μM).
      Fermented marine blue mussel
      (Mytilus edulis)
      His-Phe-Gly-Asp-Pro-Phe-HisIC50 values for radical scavenging activity, superoxide (21 μM), hydroxyl (34 μM), carbon-centered (52 μM), and DPPH radicals (96 μM). Fe2+ chelating effect. Increase t-BHP-induced WI-38 cell viability.[66]
      Hard-shelled mussel (Mytilus coruscus)
      papain hydrolysate
      Ser-Leu-Pro-Ile-Gly-Leu-Met-Ile-Ala-MetIn AAPH administered mice, inhibited malondialdehyde levels per thiobarbituric acid reactive substances assay, and increased superoxide dismutase and glutathione-s-transferase activities.[68]
      Krill (Euphausia superba) protein pepsin hydrolysateAla-Met-Val-Asp-Ala-I le-Ala-ArgIC50 value of 0.87 for DPPH radical scavenging assay and ORAC value of 1.56 mM Trolox equivalents/mM peptide. Reduce H2O2-induced oxidative stress in Chang liver cells by increasing superoxide dismutase, glutathione peroxidase, and catalase activities.[69]

      Table 2. 

      Antioxidant peptides obtained from marine organisms.

    • Peptide sequenceBioactivityReference
      American lobster (Homarus americanus) hemocytesGln-Tyr-Gly-Asn-Leu-Leu-Ser-Leu-Leu-Asn-Gly-Tyr-ArgEffective against some gram-negative bacteria. Indicate protozoastatic activity against ciliate parasites.[72]
      Rainbow trout (Oncorhynchuss mykiss) omBD-1ASFPWACPSLNGVCRKVCLPTELFFGPLGCGKGFLCCVSHFLβ-defensin-like peptide sequence. Provide resistance against viral hemorrhagic septicemia rhabdovirus (VHSV) infection in fish cell line Epithelioma papulosum cyprinid.[73]
      Channel catfish(Ictalurus punctatus) HbβP-1AANFGPSVFTPEVHETWQKFLNVVVAALGKQYHHomologous to β-chain of hemoglobin. Antiparasitic activity against Ichthyophthirius multifiliis and Aeromonas hydrophila infection in channel catfish.[74]
      Hemocyte extracts of Spider
      crab (Hyas Araneus)
      MERRTLLVVLLVCSCVVAAAAEASPSRWPSPGRPRPFPGRPKPIArasin 1, effectively inhibits the growth of Corynebacterium glutamicum, Listonella anguillarum, and E. coli.[71]

      Table 3. 

      Antimicrobial peptides derived from marine organisms.

    • Protein source and hydrolysis methodBioactivityReference
      Chlorella-derived peptides hot water extractReduce UVB-induced production of MMP-1 MCP-1, expression of CYR61, c-fos, c-jun, and increase procollagen and TbRII expression, in skin fibroblasts via attenuating AP-1 expression and production of CYR61 and MCP-1.[78]
      Tuna roe trypsin and alkaline 1:2 hydrolysate. Peptides Ile-Cys-Arg-Asp and Leu-Cys-Gly-Glu-CysInhibit UVB-induced apoptosis and alter Keap1/Nrf2-ARE pathway in HaCaT keratinocytes and mice. Inhibit the release of the proinflammatory cytokines.[79]
      Simulated gastrointestinal digest of grass carp fish scale gelatin hydrolysate (Phe-Thr-Gly-Met-Leu)Tyrosinase inhibition with an IC50 value of 1.89 mmol/L and inhibition of melanin production in the zebrafish model.[80]
      Skin collagen of Atlantic Codfish (Gadus morhua).Water retaining ability. No toxicity or inflammatory response in HaCaT cells.[77]
      Tilapia collagen nanofibersSignificantly increase HaCaT cell proliferation and accelerates epidermal differentiation through upregulating involucrin, filaggrin, and type I transglutaminase expression. Accelerate wound healing in Sprague–Dawley rats by promoting re-epithelialization.[20]
      Type I collagen from Magalaspis cordyla and Otolithes ruber bonesAccelerate wound healing in Wistar rats[21]
      Tilapia and grey mullet collagenEnhances cell adhesion, antibacterial activity (Streptococcus mutans, Staphylococcus aureus, E. coli and Bacillus subtills), faster wound healing in Sprague Dawley male rats.[22]
      Mrigal carp (Cirrhinus cirrhosus) scale collagenEfficient cell growth and proliferation on the collagen sponge. Fibroblast and keratinocyte co-culture indicated the development of a stratified epidermal layer. Faster wound healing, dermal reconstitution, and re-epithelialization in Wistar rats.[81]
      Low-molecular-weight collagen peptides from Starfish (Asterias pectinifera)Promotes wound healing, bone regeneration, and skin protection. Reduce MMP-1 expression caused by ultraviolet radiation-induced photoaging in CCD-986sk human dermal fibroblasts.[23]

      Table 4. 

      The cosmetic potential of marine peptides and protein hydrolysates.