Search
2024 Volume 3
Article Contents
ARTICLE   Open Access    

Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal

More Information
  • Given the side effects associated with synthetic antihypertensive drugs, there is a growing need among researchers to investigate angiotensin-converting enzyme (ACE) inhibitory peptides derived from food protein as safer therapeutic alternatives. This study used seabuckthorn (Hippophae rhamnoides L.) seed meal as the raw material, and the protein was extracted by alkaline extraction and acid precipitation. After enzymatic digestion, peptides with molecular weight less than 3 kDa were selected for study. The screened peptide had an IC50 value of 4.358 mg/mL on ACE with a non-competitive inhibition mechanism and good inhibition stability. By employing infrared (IR) analysis, exclusively β-fold and β-helix structures were identified in the hydrolysate, while no other structural motifs were detected. X-ray diffraction revealed that it had an irregular amorphous structure. The peptide contains 17 amino acids that are both highly acidic and hydrophobic, with glutamic acid ranking first in terms of the number of individual amino acids. Compared with the database (NCBI, Uniport), ten peptides with ACE inhibitory activity were detected, and molecular docking showed the mechanism of each peptide inhibiting ACE, FRVAWTEKNDGQRAPLANN, LIISVAYARVAKKLWLCNMIGDVT-TEQY, VIRSRASDGCLEVKEFEDIPP, AGGGG-GGGGGGSRRL, LQPREGPAGGTT-ALREELSLGPEAALDTPPAGP, DDEARINQLFL, FAVSTLTSYDWSDRDDATQGR-KL, RQLSLEGSGLGVEDLKDN, GGGGGGGGGGGGGGGIGGGGGGGGGGGAR, and KEALGEGCFGNRIDRIGD. According to the results, AGGGGGG-GGGGSRRL is more stable in binding to ACE and may have better inhibitory activity. It has been shown that seabuckthorn protein can be an alternative source of ACE inhibitory peptides.
  • 加载中
  • [1]

    Abdelhedi O, Nasri M. 2019. Basic and recent advances in marine antihypertensive peptides: Production, structure-activity relationship and bioavailability. Trends in Food Science & Technology 88:543−57

    doi: 10.1016/j.jpgs.2019.04.002

    CrossRef   Google Scholar

    [2]

    WHO. 2017. Global Health Observatory (GHO) Data. Raised Blood Pressure-situation and trends

    [3]

    Wu J, Xie D, Chen X, Tang YJ, Wang L, et al. 2019. Inhibitory mechanism of a substrate-type angiotensin I-converting enzyme inhibitory peptide. Process Biochemistry 79:97−104

    doi: 10.1016/j.procbio.2018.12.018

    CrossRef   Google Scholar

    [4]

    Ritchey MD, Gillespie C, Wozniak G, Shay CM, Thompson-Paul AM, et al. 2018. Potential need for expanded pharmacologic treatment and lifestyle modification services under the 2017 ACC/AHA Hypertension Guideline. Journal of Clinical Hypertension 20:1377−91

    doi: 10.1111/jch.13364

    CrossRef   Google Scholar

    [5]

    Tedla YG, Bautista LE. 2016. Drug Side Effect Symptoms and Adherence to Antihypertensive Medication. American Journal of Hypertension 29:772−79

    doi: 10.1093/ajh/hpv185

    CrossRef   Google Scholar

    [6]

    Aluko RE. 2015. Antihypertensive Peptides from Food Proteins. Annual Review of Food Science and Technology 6:235−62

    doi: 10.1146/annurev-food-022814-015520

    CrossRef   Google Scholar

    [7]

    Khurana V, Goswami B. 2022. Angiotensin converting enzyme (ACE). Clinica Chimica Acta 524:113−22

    doi: 10.1016/j.cca.2021.10.029

    CrossRef   Google Scholar

    [8]

    Zhao Y, Xu C. 2008. Structure and Function of Angiotensin Converting Enzyme and Its Inhibitors. Chinese Journal of Biotechnology 24:171−76

    doi: 10.1016/S1872-2075(08)60007-2

    CrossRef   Google Scholar

    [9]

    Qiao QQ, Luo QB, Suo SK, Zhao YQ, Chi CF, et al. 2022. Preparation, characterization, and cytoprotective effects on HUVECs of fourteen novel angiotensin-I-converting enzyme inhibitory peptides from protein hydrolysate of tuna processing by-products. Frontiers in Nutrition 9:868681

    doi: 10.3389/fnut.2022.868681

    CrossRef   Google Scholar

    [10]

    Wei G, Wang T, Li Y, He R, Huang A, et al. 2024. Identification, structural characterization, and molecular dynamic simulation of ACE inhibitory peptides in whey hydrolysates from Chinese Rushan cheese by-product. Food Chemistry: X 21:101211

    doi: 10.1016/j.fochx.2024.101211

    CrossRef   Google Scholar

    [11]

    Lin Z, Wu H, Zhang M. 2023. Isolation, identification, and structure-activity relationship of novel ACE inhibitory peptides from earthworm protein in vitro gastrointestinal digestion product. Food Bioscience 55:103010

    doi: 10.1016/j.fbio.2023.103010

    CrossRef   Google Scholar

    [12]

    Hu YD, Xi QH, Kong J, Zhao YQ, Chi CF, et al. 2023. Angiotensin-I-Converting Enzyme (ACE)-inhibitory peptides from the collagens of Monkfish (Lophius litulon) Swim Bladders: isolation, characterization, molecular docking analysis and activity evaluation. Marine Drugs 21:516

    doi: 10.3390/md21100516

    CrossRef   Google Scholar

    [13]

    Suo SK, Zheng SL, Chi CF, Luo HY, Wang B. 2022. Novel angiotensin-converting enzyme inhibitory peptides from tuna byproducts—milts: Preparation, characterization, molecular docking study, and antioxidant function on H2O2-damaged human umbilical vein endothelial cells. Frontiers in Nutrition 9:957778

    doi: 10.3389/fnut.2022.957778

    CrossRef   Google Scholar

    [14]

    Yushipitsina GG, Chuprova NA, Repyakh SM. 1988. Fractionation and amino acid compositon of proteins of the woody verdure of sea buckthorn. Chemistry of Natural Compounds 24:348−50

    doi: 10.1007/BF00598585

    CrossRef   Google Scholar

    [15]

    Biel W, Telesiński A, Jaroszewska A, Biel W. 2018. Effect of mycorrhization and variety on the chemical composition and antioxidant activity of sea buckthorn berries. Journal of Elementology 23:673−84

    doi: 10.5601/jelem.2017.22.3.1434

    CrossRef   Google Scholar

    [16]

    Larmo PS, Järvinen RL, Setälä NL, Yang B, Viitanen MH, et al. 2010. Oral sea buckthorn oil attenuates tear film osmolarity and symptoms in individuals with dry eye. The Journal of Nutrition 140:1462−68

    doi: 10.3945/jn.109.118901

    CrossRef   Google Scholar

    [17]

    Xing J, Yang B, Dong Y, Wang B, Wang J, et al. 2002. Effects of sea buckthorn (Hippophaë rhamnoides L.) seed and pulp oils on experimental models of gastric ulcer in rats. Fitoterapia 73:644−50

    doi: 10.1016/s0367-326x(02)00221-6

    CrossRef   Google Scholar

    [18]

    Li J, Su J, Chen M, Chen J, Ding W, et al. 2021. Two novel potent ACEI peptides isolated from Pinctada fucata meat hydrolysates using in silico analysis: identification, screening and inhibitory mechanisms. RSC Advances 11:12172−82

    doi: 10.1039/D0RA10476K

    CrossRef   Google Scholar

    [19]

    Sosulski FW, Holt NW. 1980. Amino acid composition and nitrogen-to-protein factors for grain legumes. Canadian Journal of Plant Science 60:1327−31

    doi: 10.4141/cjps80-187

    CrossRef   Google Scholar

    [20]

    Zhu Y, Huang Y, Li M, Sun B, Liu L, et al. 2023. High Fischer ratio peptide of hemp seed: Preparation and anti-fatigue evaluation in vivo and in vitro. Food Research International 165:112534

    doi: 10.1016/j.foodres.2023.112534

    CrossRef   Google Scholar

    [21]

    Zhao C, Chu Z, Miao Z, Liu J, Liu J, et al. 2021. Ultrasound heat treatment effects on structure and acid-induced cold set gel properties of soybean protein isolate. Food Bioscience 39:100827

    doi: 10.1016/j.fbio.2020.100827

    CrossRef   Google Scholar

    [22]

    Lin N, Liu B, Liu Z, Qi T. 2020. Effects of different drying methods on the structures and functional properties of phosphorylated Antarctic krill protein. Journal of Food Science 85:3690−99

    doi: 10.1111/1750-3841.15503

    CrossRef   Google Scholar

    [23]

    Lear S, Cobb SL. 2016. Pep-Calc.com: a set of web utilities for the calculation of peptide and peptoid properties and automatic mass spectral peak assignment. Journal of Computer-Aided Molecular Design 30:271−77

    doi: 10.1007/s10822-016-9902-7

    CrossRef   Google Scholar

    [24]

    Cushman DW, Cheung HS. 1971. Spectrophotometric assay and properties of the angiotensin-converting enzyme of rabbit lung. Biochemical Pharmacology 20:1637−48

    doi: 10.1016/0006-2952(71)90292-9

    CrossRef   Google Scholar

    [25]

    Yang B, Kallio H. 2002. Effects of harvesting time on triacylglycerols and glycerophospholipids of sea buckthorn (Hippophaë rhamnoides L.) berries of different origins. Journal of Food Composition and Analysis 15:143−57

    doi: 10.1006/jfca.2001.1041

    CrossRef   Google Scholar

    [26]

    Lee SH, Qian ZJ, Kim SK. 2010. A novel angiotensin I converting enzyme inhibitory peptide from tuna frame protein hydrolysate and its antihypertensive effect in spontaneously hypertensive rats. Food Chemistry 118:96−102

    doi: 10.1016/j.foodchem.2009.04.086

    CrossRef   Google Scholar

    [27]

    Fu X, Yang H, Ma C, Li X, Li D, et al. 2020. Characterization and inhibitory activities on α-amylase and α-glucosidase of the polysaccharide from blue honeysuckle berries. International Journal of Biological Macromolecules 163:414−22

    doi: 10.1016/j.ijbiomac.2020.06.267

    CrossRef   Google Scholar

    [28]

    Li L, Cai Y, Sun X, Du X, Jiang Z, et al. 2021. Tyrosinase inhibition by p-coumaric acid ethyl ester identified from camellia pollen. Food Science & Nutrition 9:389−400

    doi: 10.1002/fsn3.2004

    CrossRef   Google Scholar

    [29]

    Wang C, Tian J, Wang Q. 2011. ACE inhibitory and antihypertensive properties of apricot almond meal hydrolysate. European Food Research and Technology 232:549−56

    doi: 10.1007/s00217-010-1411-7

    CrossRef   Google Scholar

    [30]

    Ciesarová Z, Murkovic M, Cejpek K, Kreps F, Tobolková B, et al. 2020. Why is sea buckthorn (Hippophae rhamnoides L.) so exceptional? A review. Food Research International 133:109170

    doi: 10.1016/j.foodres.2020.109170

    CrossRef   Google Scholar

    [31]

    Zhang Z, Wang Y, Dai C, He R, Ma H. 2018. Alkali extraction of rice residue protein isolates: Effects of alkali treatment conditions on lysinoalanine formation and structural characterization of lysinoalanine-containing protein. Food Chemistry 261:176−83

    doi: 10.1016/j.foodchem.2018.04.027

    CrossRef   Google Scholar

    [32]

    Ghribi AM, Gafsi IM, Blecker C, Danthine S, Attia H, et al. 2015. Effect of drying methods on physico-chemical and functional properties of chickpea protein concentrates. Journal of Food Engineering 165:179−88

    doi: 10.1016/j.jfoodeng.2015.06.021

    CrossRef   Google Scholar

    [33]

    Hu Y, Que T, Fang Z, Liu W, Chen S, et al. 2013. Effect of Different Drying Methods on the Protein and Product Quality of Hairtail Fish Meat Gel. Drying Technology 31:1707−14

    doi: 10.1080/07373937.2013.794831

    CrossRef   Google Scholar

    [34]

    Suetsuna K, Nakano T. 2000. Identification of an antihypertensive peptide from peptic digest of wakame (Undaria pinnatifida). The Journal of Nutritional Biochemistry 11:450−54

    doi: 10.1016/S0955-2863(00)00110-8

    CrossRef   Google Scholar

    [35]

    Cheung HS, Wang FL, Ondetti MA, Sabo EF, Cushman DW. 1980. Binding of peptide substrates and inhibitors of angiotensin-converting enzyme. Importance of the COOH-terminal dipeptide sequence. Journal of Biological Chemistry 255:401−7

    Google Scholar

    [36]

    Hayes M, Mora L, Hussey K, Aluko RE. 2016. Boarfish protein recovery using the pH-shift process and generation of protein hydrolysates with ACE-I and antihypertensive bioactivities in spontaneously hypertensive rats. Innovative Food Science & Emerging Technologies 37:253−60

    doi: 10.1016/j.ifset.2016.03.014

    CrossRef   Google Scholar

    [37]

    Badertscher M, Bühlmann P, Pretsch E. 2009. Structure determination of organic compounds: Tables of Spectral Data. 4th Edition. Heidelberg: Springer Berlin. doi: 10.1007/978-3-540-93810-1

    [38]

    Ma FF, Wang H, Wei CK, Thakur K, Wei ZJ, et al. 2018. Three novel ACE inhibitory peptides isolated from Ginkgo biloba seeds: purification, inhibitory kinetic and mechanism. Frontiers in Pharmacology 9:1579

    doi: 10.3389/fphar.2018.01579

    CrossRef   Google Scholar

    [39]

    Toopcham T, Mes JJ, Wichers HJ, Roytrakul S, Yongsawatdigul J. 2017. Bioavailability of angiotensin I-converting enzyme (ACE) inhibitory peptides derived from Virgibacillus halodenitrificans SK1-3-7 proteinases hydrolyzed tilapia muscle proteins. Food Chemistry 220:190−97

    doi: 10.1016/j.foodchem.2016.09.183

    CrossRef   Google Scholar

    [40]

    Zhang Y, Pan D, Yang Z, Gao X, Dang Y. 2021. Angiotensin I-Converting enzyme (ACE) inhibitory and dipeptidyl Peptidase-4 (DPP-IV) inhibitory activity of umami peptides from Ruditapes philippinarum. LWT 144:111265

    doi: 10.1016/j.lwt.2021.111265

    CrossRef   Google Scholar

    [41]

    Chen J, Ryu B, Zhang Y, Liang P, Li C, et al. 2020. Comparison of an angiotensin-I-converting enzyme inhibitory peptide from tilapia (Oreochromis niloticus) with captopril: inhibition kinetics, in vivo effect, simulated gastrointestinal digestion and a molecular docking study. Journal of the Science of Food and Agriculture 100:315−24

    doi: 10.1002/jsfa.10041

    CrossRef   Google Scholar

    [42]

    Quirós A, Ramos M, Muguerza B, Delgado MA, Miguel M, et al. 2007. Identification of novel antihypertensive peptides in milk fermented with Enterococcus faecalis. International Dairy Journal 17:33−41

    doi: 10.1016/j.idairyj.2005.12.011

    CrossRef   Google Scholar

    [43]

    Iroyukifujita H, Eiichiyokoyama K, Yoshikawa M. 2000. Classification and Antihypertensive Activity of Angiotensin I-Converting Enzyme Inhibitory Peptides Derived from Food Proteins. Journal of Food Science 65:564−69

    doi: 10.1111/j.1365-2621.2000.tb16049.x

    CrossRef   Google Scholar

    [44]

    Natesh R, Schwager SLU, Sturrock ED, Acharya KR. 2003. Crystal structure of the human angiotensin-converting enzyme-lisinopril complex. Nature 421:551−54

    doi: 10.1038/nature01370

    CrossRef   Google Scholar

    [45]

    Sánchez-Rivera L, Ares I, Miralles B, Gómez-Ruiz JÁ, Recio I, et al. 2014. Bioavailability and Kinetics of the Antihypertensive Casein-Derived Peptide HLPLP in Rats. Journal of Agricultural and Food Chemistry 62:11869−75

    doi: 10.1021/jf5035256

    CrossRef   Google Scholar

    [46]

    Wu J, Aluko RE, Nakai S. 2006. Structural requirements of angiotensin I-converting enzyme inhibitory peptides: quantitative structure−activity relationship study of di- and tripeptides. Journal of Agricultural and Food Chemistry 54:732−38

    doi: 10.1021/jf051263l

    CrossRef   Google Scholar

    [47]

    Wu J, Liao W, Udenigwe CC. 2017. Revisiting the mechanisms of ACE inhibitory peptides from food proteins. Trends in Food Science & Technology 69:214−19

    doi: 10.1016/j.jpgs.2017.07.011

    CrossRef   Google Scholar

    [48]

    Li M, Fan W, Xu Y. 2021. Identification of angiotensin converting enzyme (ACE) inhibitory and antioxidant peptides derived from Pixian broad bean paste. LWT 151:112221

    doi: 10.1016/j.lwt.2021.112221

    CrossRef   Google Scholar

    [49]

    Fan H, Wang J, Liao W, Jiang X, Wu J. 2019. Identification and Characterization of Gastrointestinal-Resistant Angiotensin-Converting Enzyme Inhibitory Peptides from Egg White Proteins. Journal of Agricultural and Food Chemistry 67:7147−56

    doi: 10.1021/acs.jafc.9b01071

    CrossRef   Google Scholar

    [50]

    Fan H, Wu J. 2021. Purification and identification of novel ACE inhibitory and ACE2 upregulating peptides from spent hen muscle proteins. Food Chemistry 345:128867

    doi: 10.1016/j.foodchem.2020.128867

    CrossRef   Google Scholar

    [51]

    Ma T, Fu Q, Mei Q, Tu Z, Zhang L. 2021. Extraction optimization and screening of angiotensin-converting enzyme inhibitory peptides from Channa striatus through bioaffinity ultrafiltration coupled with LC-Orbitrap-MS/MS and molecular docking. Food Chemistry 354:129589

    doi: 10.1016/j.foodchem.2021.129589

    CrossRef   Google Scholar

    [52]

    Wei D, Fan WL, Xu Y. 2021. Identification of water-soluble peptides in distilled spent grain and its angiotensin converting enzyme (ACE) inhibitory activity based on UPLC-Q-TOF-MS and proteomics analysis. Food Chemistry 353:129521

    doi: 10.1016/j.foodchem.2021.129521

    CrossRef   Google Scholar

    [53]

    Lu Y, Wang Y, Huang D, Bian Z, Lu P, et al. 2021. Inhibitory mechanism of angiotensin-converting enzyme inhibitory peptides from black tea. Journal of Zhejiang University: Science 22:575−89

    doi: 10.1631/jzus.B2000520

    CrossRef   Google Scholar

  • Cite this article

    Zheng Y, Wang D, Zhou Y, Yuen M, Yuen T, et al. 2024. Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal. Food Innovation and Advances 3(3): 295−304 doi: 10.48130/fia-0024-0029
    Zheng Y, Wang D, Zhou Y, Yuen M, Yuen T, et al. 2024. Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal. Food Innovation and Advances 3(3): 295−304 doi: 10.48130/fia-0024-0029

Figures(4)  /  Tables(4)

Article Metrics

Article views(91) PDF downloads(26)

ARTICLE   Open Access    

Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal

Food Innovation and Advances  3 2024, 3(3): 295−304  |  Cite this article

Abstract: Given the side effects associated with synthetic antihypertensive drugs, there is a growing need among researchers to investigate angiotensin-converting enzyme (ACE) inhibitory peptides derived from food protein as safer therapeutic alternatives. This study used seabuckthorn (Hippophae rhamnoides L.) seed meal as the raw material, and the protein was extracted by alkaline extraction and acid precipitation. After enzymatic digestion, peptides with molecular weight less than 3 kDa were selected for study. The screened peptide had an IC50 value of 4.358 mg/mL on ACE with a non-competitive inhibition mechanism and good inhibition stability. By employing infrared (IR) analysis, exclusively β-fold and β-helix structures were identified in the hydrolysate, while no other structural motifs were detected. X-ray diffraction revealed that it had an irregular amorphous structure. The peptide contains 17 amino acids that are both highly acidic and hydrophobic, with glutamic acid ranking first in terms of the number of individual amino acids. Compared with the database (NCBI, Uniport), ten peptides with ACE inhibitory activity were detected, and molecular docking showed the mechanism of each peptide inhibiting ACE, FRVAWTEKNDGQRAPLANN, LIISVAYARVAKKLWLCNMIGDVT-TEQY, VIRSRASDGCLEVKEFEDIPP, AGGGG-GGGGGGSRRL, LQPREGPAGGTT-ALREELSLGPEAALDTPPAGP, DDEARINQLFL, FAVSTLTSYDWSDRDDATQGR-KL, RQLSLEGSGLGVEDLKDN, GGGGGGGGGGGGGGGIGGGGGGGGGGGAR, and KEALGEGCFGNRIDRIGD. According to the results, AGGGGGG-GGGGSRRL is more stable in binding to ACE and may have better inhibitory activity. It has been shown that seabuckthorn protein can be an alternative source of ACE inhibitory peptides.

    • As societal standards have risen, hypertension has emerged as a significant chronic health concern, affecting approximately 30% of the adult population in most countries[1,2]. Furthermore, it has been identified as the leading cause of mortality worldwide, accounting for 12.8% of all deaths[2]. The population of hypertension patients is expected to increase to 1.5 billion by 2025[3]. Despite synthetic drugs being a standard treatment for hypertension, 50% of patients still have blood pressure that is not adequately controlled[4]. In addition, the long-term use of drugs will produce potential side effects, increase patients' non-compliance to drugs, and endanger patients' health[5]. This has led to a new trend to find food-derived active peptides that effectively inhibit hypertension instead of chemical synthetic agents[6].

      Angiotensin-converting enzyme (ACE) was isolated in 1956 and used as a 'hypertension-converting enzyme'[7]. ACE is a chloride and zinc-dependent dipeptidase that plays a vital role in the regulation of electrolyte balance, blood pressure regulation, cardiovascular system development, and vascular remodeling by converting angiotensin I (Ang I) to angiotensin II (Ang II) in body fluids[8]. The potential of ACE inhibitory peptides to lower blood pressure has been the subject of considerable research. The peptides have been found to exert this effect by inhibiting the binding between Ang II and the receptor, or by increasing nitric oxide (NO) levels[6,9]. For instance, in cellular experiments conducted by Qiao et al., it was demonstrated that the ACE inhibitory peptides derived from tuna effectively suppressed the binding of Ang II to its receptor on ACE through an increase in NO content[9]. Wei et al. identified two ACE inhibitory peptides, FDRPFL and KWEKPF, by enzymatic digestion of Chinese Rushan cheese by-product[10]; Lin et al. investigated the digestion products of earthworm proteins, from which they isolated seven ACE inhibitory peptides SSPLWER, RFFGP, LERWP, MFPGIADR, FPGIADR, SADRISHGF, and ADRYSSWP[11]; Hu et al. isolated three ACE inhibitory peptides, SEGPK, FDGPY, and SPGPW, from Monkfish (Lophius litulon) swim bladders[12]; Suo et al. employed alkaline protease for the preparation of tuna byproducts-milts hydrolysates and identified ten ACE inhibitory peptides[13].

      Seabuckthorn is a premium source of bioactive peptides, given its comprehensive range of amino acids and elevated proportion of essential amino acids[14]. The total protein content of various seabuckthorn from India has been reported to range from 46 to 129 g/kg dry weight (DW). The protein content in the Polish seabuckthorn variety is 93 g/kg DW[15]. It is characterized by high protein content compared to other berries such as strawberry (Fragaria ananassa Duch.) (9 g/kg DW), golden berry (Solanum mammosum L.) (18.5 g/kg DW)[16], raspberry (Rubus idaeus L.) (33−44 g/kg DW)[17]. Seabuckthorn seed meal is a by-product generated during the supercritical CO2 extraction of seabuckthorn oil. Currently, most of this by-product is employed as animal feed or discarded as waste, resulting in a significant loss of resources. The objective of this study is to extract proteins and peptides from seabuckthorn seed meals that inhibit ACE activity, thereby increasing the utilization of seabuckthorn seed meal, reducing the waste of resources, and providing an alternative option for hypertensive patients.

      In this paper, seabuckthorn seed meal protein was hydrolyzed, investigated its inhibitory activity for ACE, determined its inhibitor value, and characterized its structure. Finally, ten peptides with ACE inhibitory activity were identified by mass spectrometry and further elucidated the mechanism of its interaction at the molecular level through molecular docking.

    • The seabuckthorn seed meal was provided by Puredia Limited (Xining, Qinghai, China) and was identified to contain 30.80 g of protein per 100 g of seed meal; Sunflower oil purchased from Yihai Kerry Arawana Holdings Co. (Shanghai, China); Compound enzyme preparation ZF101 from Angel Yeast Co. (Yichang, Hubei, China); Angiotensin-converting enzyme (ACE), and Hippuryl-histidyl-leucine (HHL) from Sigma-Aldrich Chemical Co. (Beijing, China); Protein Content Assay Kit, Amino Acid (20AA), Pepsin (1:3000), Trypsin (1:250) from Beijing Solarbio Science & Technology Co. (Beijing, China), Sodium hydroxide, hydrochloric acid from Tianjin Damao Chemical Reagent Factory (Tianjin, China).

    • The seabuckthorn seed meal was crushed and screened using a 120-mesh sieve, seabuckthorn seed meal with a mesh size greater than 120 continued to be crushed until all samples passed through the sieve. The screened seabuckthorn seed meal was added with water to make a suspension with a material-to-liquid ratio of 1:30. The pH of the system was adjusted to 10 with 1 M NaOH, and the pH of the system was maintained at this level. The extraction was conducted using a magnetic stirring water bath (SHJ-2A, Changzhou Jintan Liangyou Instrument Co., Limited) at 60 °C for 80 min. Once the extraction process was complete, the supernatant was collected and the pH was adjusted to 3 with 1 M HCl. The solution was then allowed to stand for 30 min, after which centrifugation was performed at 1,043 g for 10 min. The precipitate, which constituted the seabuckthorn seed meal protein, was then lyophilized for subsequent use.

      The formula for protein yield calculation:

      $ Protein\;yield\;\left(\text{%}\right)=\dfrac{{m}_{1}}{m}\times 100 $

      where, m1: the amount of protein extracted; m: the quality of seabuckthorn seed meal used.

    • The protein of seabuckthorn seed meal was dissolved in water and prepared into a 7% (w/v) protein solution. Enzymolysis with 4.2% (w/w) compound enzyme preparation ZF101 was performed at 55 °C for 6.38 h. According to Li et al.[18], it has been demonstrated that ACE inhibitory activity is more pronounced for peptides smaller than 3 kDa. The enzyme solution was filtered through a 5 μm filter bag and then a 3 kDa filter membrane. The enzyme hydrolysate less than 3 kDa was retained for analysis.

    • Sample pretreatment

      Approximately 100 mg of the sample was placed in a 10 mL volumetric flask, then the mobile phase was sucked into the volumetric flask until it reached the calibration line, then processed with 100 W/L ultrasonic density for 5 min, centrifuged at 261 g, filtered with microporous filter membrane, and waited for sample injection.

      High-performance gel chromatography was employed to ascertain the molecular weight distribution of peptides and seabuckthorn seed meal proteins. The Waters 2695 HPLC (equipped with a 2487 UV detector and Empower workstation GPC software) was employed to ascertain the chromatographic conditions. The TSKgel 2000 SWXL column (Tosoh Biotechnology Co., LTD, Shanghai, China) was 300 mm × 7.8 mm in diameter and the mobile phase consisted of acetonitrile/water/trifluoroacetic acid in a ratio of 45/55/0.1 (V/V). Detection was carried out using a wavelength of 220 nm, with a flow rate of 0.5 mL/min, and the temperature of the column was set at 30 °C (Sigma Aldrich Trading Co., Ltd., Shanghai, China). The following compounds were used as standards for the molecular weight correction curve of seabuckthorn seed meal proteins (Sigma Aldrich Trading Co., Ltd., Shanghai, China): cytochrome C (MW 12384), trypsin inhibitor (MW 6500), bacitracin (MW 1422), Gly-Gly-Tyr-Arg (MW 451), and Gly-Gly-Gly (MW 189). Bovine albumin (MW 67000), ovalbumin (MW 45000), chymotrypsinogen A (MW 24000), and lysozyme (MW 14300).

    • The trichloroacetic acid nitrogen solubility index method (TCA-SNI) was employed, with slight modification. Insoluble proteins in solution were precipitated with trichloroacetic acid, and following centrifugation, the nitrogen content in the supernatant was determined using the Kjeldahl nitrogen method[19]. The specific method was to take 1 mL of protein hydrolysate, add 3 mL trichloroacetic acid solution, shake and mix for 15 min, then centrifuge at 1,043 g for 10 min, take the supernatant, and use a Protein Content Assay Kit (Biuret Method) to determine peptide content.

      The formula for the calculation of polypeptide yield:

      $ Yield\;of\;peptides\;\left(\text{%}\right)=\dfrac{{n}_{1}}{n}\times 100 $

      where, n1: peptide content in the supernatant; n: the amount of protein consumed.

    • With certain modifications based on the methodology proposed by Zhu et al.[20]. A quantity of the sample was subjected to hydrolysis with 6 M HCl at 110 °C for 22 h, then removed and neutralized with NaOH. Following this, it was filtered through a 22 μm membrane and assayed. HPLC parameters (Waters2695, equipped with 2487 UV detector and Empower workstation GPC software, Agilent, USA), chromatographic conditions: Column: C18 SHISEIDO (Shanghai Inguang Trading Co., Ltd., Shanghai, China) (4.6 mm × 250 mm × 5 μm); injection volume: 10 μL; column temperature: 40 °C; The flow rate was stabilized at 1.0 mL/min. UV detection conditions were as follows: the wavelength was 338 nm and changed to 262 nm at 22.5 min. Fluorescence detector conditions: excitation wavelength 340 nm, emission wavelength 450 nm, 22.5 min excitation wavelength changed to 266 nm, emission wavelength 305 nm; Mobile phase: A: sodium acetate-triethylamine-tetrahydrofuran solution, B: sodium acetate-acetonitrile-methanol solution; Standard: 17 amino acids (Sigma Aldrich Trading Co., ltd., Shanghai, China).

    • The sample lyophilized powder (2 mg) was mixed with 200 mg of dried KBr. The mixture was then ground evenly with an agate mortar, pressed, and scanned with an infrared spectrometer (VERTEX70, VERTEX, Germany) with a KBr background in the spectral range 4,000−500 cm−1. Software Origin 2019 was used for mapping, and PeakFit v4.12 software was used for analysis. Two-point baseline correction was performed in the spectral range 1,600−1,700 cm−1, followed by Savitsky-Golay function smoothing, and fitted in second derivative spectra. Manual fitting can be performed multiple times to reduce the residual error (R2 ≥ 0.999). The percentage of secondary structure based on the area of each peak was calculated[21].

    • Adjustments were made according to Lin et al.[22]. Samples were examined using an X-ray diffractometer (D8ADVANCEA25, Bruker, Germany) at a voltage of 40 kV and a current of 40 mA with a step scan of 0.02° from 5° to 70°.

    • Peptides were identified by Quadrupole-TOF LC-MS/MS System. The analytical column used in capillary liquid chromatography: Mobile phase A: 0.1% formic acid; Mobile phase B: 0.1% formic acid and 80% acetonitrile; Flow rate: 300 nL/min. Primary mass spectrometry parameters: Resolution: 60000; AGC target: 4.0e5; Maximum IT: 100 ms; Scan range: 375−1,500. Secondary mass spectrometry parameters: Resolution: 15,000; AGC target: 5.0e4; Maximum IT: 256 ms. The range scan mode is m/z Normal (Auto), and the HCD Collision Energy (%) is 30. The isoelectric point (pI), net charge, and solubility of peptides were calculated using the method used by Lear & Cobb[23].

    • The borate buffer was prepared with a pH of 8.3, an 8 mM HHL solution, and an ACE solution with an activity of 0.1 U/mL. Three test tubes were prepared and designated as sample A, control B, and blank C. Each test tube was then supplied with 200 mL of the HHL solution, 250 mL of HCl to test tube C and 100 mL of the enzymatic hydrolysate. Test tube A was placed in a water bath set at 37 °C for 5 min. Subsequently, 20 mL of ACE solution was added to each of the three test tubes, which were then incubated in the water bath for an additional 30 min. Then, an HCl solution was added to test tubes A and B, and a borate buffer solution was added to test tubes B and C to make them react. After the reaction, 1.7 mL ethyl acetate was added to each tube and full reaction 20 s before allowing it to stand until the liquid stratified. 1 mL of the ethyl acetate layer was removed from each tube and placed into a drying oven at 120 °C for 30 min. After drying, the tube was removed and the solution was prepared in 3 mL of ultra-pure water. The UV spectrophotometer was then calibrated to 228 nm to measure the absorbance value of the dissolved solution[2426]. The enzymatic solution was diluted to five concentration gradients, and the measured results were analyzed by IC50. The calculation formula is as follows:

      ${\rm ACE\; inhibition\; rate\; ({\text{%}})} =\dfrac{{A}_{B}-{A}_{A}}{{A}_{B}-{A}_{C}}\times 100 $

      where, AB: Absorbance of the control tube; AA: Absorbance of the sample tube; AC: Absorbance values of blank tubes.

    • Peptides less than 3 kDa were diluted and divided into three concentrations: 19.5, 9.75, and 0 mg/mL. The reaction was carried out at four different concentrations of HHL (8.0, 4.0, 2.0, and 0.8 mmol/L, respectively). The reciprocal of the reaction rate (1/V) is used as the ordinate and the reciprocal of the substrate concentration (1/[S]) as the abscissa Lineweaver-Burk double reciprocal plot was made to analyze the inhibition pattern, and the inhibition constants Km and Vmax were calculated by the intercept between the line and the horizontal and vertical coordinates[27,28].

    • According to Wang's team[29], the stability of peptides at different temperatures and pH was determined. Peptide solutions with a molecular weight of less than 3 kDa were subjected to a water bath treatment at temperatures of 4, 20, 40, 80, and 100 °C for 2 h. Following this, the inhibitory rate on ACE was determined. The peptide solution of less than 3 kDa was kept at pH 2, 4, 6, 8, 10, and 12 at 37 °C for 2 h, and the pH was adjusted to 8.3 to determine the ACE inhibition rate of the peptide.

    • The 1O8A crystal in the RCSB PDB database (PDB DOI: 10.2210/pdb1O8A/pdb) was used as the acceptor ACE structure in this section, and the Zn and Cl atoms in 1O8A were retained and saved in pdb format for use during docking. The molecular structure of the ACE inhibitory peptide was plotted using the Chemdraw18.0 software, and the energy of the molecular structure was minimized. The molecular docking was performed with the software AutoDockTools-1.5.6, and the center coordinates of the docking box were 40.575 in x, 37.430 in y, and 43.759 in z. The Analyze program in AutoDockTools-1.5.6 software was used to view and analyze the results, and PyMOL software was used to plot the docking results for ACE and peptides.

    • ​All samples were measured at least three times, and data were represented as average ± standard deviation. The data were analyzed using IBM SPSS Statistics 27.

    • The preparation of seabuckthorn seed meal peptides is shown in Fig. 1. Seabuckthorn seed meal, which is a byproduct of the oil extracted from seabuckthorn seeds, contains a considerable concentration of protein and a plethora of amino acids. This quality renders seabuckthorn seed meal a superior source of protein[30]. In this experiment, seabuckthorn seed meal was crushed, and seabuckthorn protein was extracted by alkaline extraction and acid precipitation, and the protein yield was 27.66%. The protein extraction rate increased with the increase in pH. However, too high a pH leads to the production of a toxic lysinoalalnine protein that leads to the passivation of metalloenzymes and nephrotoxicity and further compromises the nutritional value of foods[31]. To better preserve the flavor, color, structure, and nutrition of seabuckthorn seed meal protein, freeze-drying was selected[32,33]. To optimize the industrial production of seabuckthorn seed meal peptide, a food-grade enzyme preparation was used. The optimal pH for enzyme activity was neutral, which reduced the production of inorganic salts and avoided the loss of equipment in the production process. After enzymatic digestion with ZF101 protein, the yield of polypeptides obtained from seabuckthorn seed meal was 24.29%.

      Figure 1. 

      Preparation of ACE inhibitory peptides from seabuckthorn seed meal.

    • The MW distribution of seabuckthorn seed meal protein before and after enzymatic digestion is shown in Tables 1 & 2. Table 1 shows that the molecular weight of seabuckthorn seed meal protein is relatively large, mainly distributed in the range of 50~10 kDa, with an average molecular weight of 170,280 Da. Following enzymatic hydrolysis, the molecular weight of peptides is markedly diminished, with the average molecular weight reduced to 2,842 Da. Most of these peptides have a molecular weight below 3 kDa, representing 63.41% of the total. The free amino group (< 180 Da) was 14.44%. The content of peptides in the range of 180−3,000 Da was 48.97%.

      Table 1.  Test results of protein MW of seabuckthorn seed meal.

      MW (Da) PAP (%) NAMW (Da) WAMW (Da)
      > 500 k 13.98 768,704 803,432
      500 k~100 k 15.45 191,719 239,242
      100 k~50 k 11.52 67,218 69,982
      50 k~20 k 26.88 30,453 32,557
      20 k~10 k 24.98 14,362 14,858
      < 10 k 7.19 4,191 6,573

      Table 2.  Determination of polypeptide MW of seabuckthorn seed meal.

      MW (Da) PAP (%) NAMW (Da) WAMW (Da)
      > 10000 3.26 11,507 11,678
      10,000~5,000 19.40 6,760 7,012
      5,000~3,000 13.93 3,871 3,956
      3,000~2,000 8.84 2,448 2,482
      2,000~1,000 12.38 1,401 1,458
      1,000~500 11.09 698 725
      500~180 16.66 283 304
      < 180 14.44 / /
      MW, Molecular weight; PAP, peak area percentage; NAMW, number average molecular weight; WAMW, weight average molecular weight.
    • Based on the analysis shown in Table 3, the polypeptide of seabuckthorn seed meal contains 17 amino acids, a total of 53.61 g/100 g, of which the proportion of essential amino acids is 27.88. According to the nature of amino acids, the content of acidic amino acids was the highest (39.33%), followed by hydrophobic amino acids (29.24%) and aromatic amino acids (5.88%). According to Cheung et al. and Suetsuna's & Nakano, the composition and content of amino acids play an essential role in ACE inhibition[34,35]. Hayes et al. found that hydrophobic amino acids, such as Phe, Trp, Tyr, Val, Leu, and Ile, favored to combine with the C-terminal active site of ACE[36]. Additionally, C-terminal amino acid residues containing positive charge, such as Lys and Arg, could be conducive to increasing the ACEi activity of peptides. Pro arouses great attention of researchers because Pro occurs frequently at the C-terminus of antihypertensive peptides, such as LYPPP, YSMYPP, VGLYP, EVSQGRP, YP, and KDEDTEEVP[1]. This is consistent with the amino acid composition analyzed in this assay.

      Table 3.  Amino acid composition analysis.

      Name Time
      (min)
      Area
      (mau*s)
      Content
      (g/100 g)
      Proportion of
      total amino
      acid content
      Aspartic acid (Asp) 2.953 696.862 6.366 11.873%
      Glutamic (Glu) 3.400 1327.706 14.757 27.525%
      Serine (Ser) 6.851 363.541 2.638 4.921%
      Histidine (His) 7.780 62.961 1.148 2.141%
      Glycine (Gly) 8.724 412.175 2.162 4.033%
      Threonine (Thr) 9.093 180.797 1.534 2.860%
      Arginine (Arg) 10.430 696.119 8.622 16.082%
      Alanine (Ala) 11.566 339.348 2.072 3.864%
      Tyrosine (Tyr) 13.934 90.650 1.239 2.311%
      Valine (Val) 17.986 294.825 2.415 4.505%
      Methionine (Met) 18.348 17.390 0.177 0.330%
      Phenylalanine (Phe) 20.963 162.056 1.918 3.577%
      Isoleucine (Ile) 21.412 217.560 1.984 3.701%
      Leucine (Leu) 22.678 399.479 3.569 6.657%
      Lysine (Lys) 23.488 243.452 1.468 2.739%
      Proline (Pro) 29.987 291.578 1.391 2.594%
      Cystine (Cys) 16.960 10.302 0.154 0.287%
    • There is an essential relationship between the secondary structure of peptides and their intramolecular bonding. Fourier transform infrared spectroscopy is a powerful method. Figure 2a shows that the peptide contains C-H, N-H, C=O, C-N, and -COO functional groups according to the fluctuations in the IR spectra[37]. According to Zhao et al.[21], the band ranges of β-folding, random coil, α-helix, and β-angle were 1,600−1,640, 1,640−1,650, 1,650−1,660, and 1,660−1,700 cm−1, respectively, which were processed by software PeakFit v4.12. The results of the amide I band (1,600−1,700 cm−1) showed that the β-fold structure was the main secondary structure with a content of 61.87% ± 1.42%. The content of the β-turn structure was 38.13% ± 1.42%, while no other structural motifs were detected.

      Figure 2. 

      (a) Infrared diffraction spectra of peptides. (b) X-ray diffraction results of peptides

    • As can be seen in Fig. 2b, the sample has a diffraction angle of 22. The figure shows a diffraction absorption characteristic peak. However, the peak intensity is low, and the background is broad, which indicates that the ACE inhibitory peptide of seabuckthorn seed meal has a random amorphous structure.

    • The detection results of peptides < 3 kDa were compared with the NCBI and Uniprot databases of ACE inhibitory peptides, and 10 ACE inhibitory peptides were detected. The results are shown in Table 4. The molecular distributions of the peptides measured in this study range from 1,000 to 3,000 Da. Except for the peptides AGGGGGGGGGGSRRL and DDEARINQLFL, which are slightly larger than 1 kDa, the rest of the peptides are more significant than 1.5 kDa, presumably because most of the peptides obtained by enzymatic hydrolysis are not recorded in the database and are not detected. Ma et al. and Toopcham's team arginine could enhance the ACE-inhibiting activity of peptides, and most of the peptides screened in this study contained arginine, similar to the amino acid sequence screened[38,39].

      Table 4.  Peptide detection results and physicochemical properties.

      Serial number Amino acid sequence Mass-to-charge ratio Isoelectric point Static charge Solubility
      1 FRVAWTEKNDGQRAPLANN 2187.105 pH 9.86 1 Good
      2 LIISVAYARVAKKLWLCNMIGDVTTEQY 3198.705 pH 8.70 0.9 Poor
      3 VIRSRASDGCLEVKEFEDIPP 2360.191 pH 4.16 −2.1 Good
      4 AGGGGGGGGGGSRRL 1172.588 pH 12.10 2 Good
      5 LQPREGPAGGTTALREELSLGPEAALDTPPAGP 3268.681 pH 3.88 −3 Good
      6 DDEARINQLFL 1333.675 pH 3.54 −2 Good
      7 FAVSTLTSYDWSDRDDATQGRKL 2632.264 pH 4.19 −1 Good
      8 RQLSLEGSGLGVEDLKDN 1929.988 pH 3.93 −2 Good
      9 GGGGGGGGGGGGGGGIGGGGGGGGGGGAR 1841.798 pH 10.84 1 Good
      10 KEALGEGCFGNRIDRIGDVSGMGCNRRTPAP 3276.578 pH 8.07 0.9 Good
    • The relationship between the concentration of ACE inhibitory peptide and the inhibition rate of seabuckthorn seed meal is shown in Fig. 3a (R2 = 0.9538). ACE inhibitory peptide concentration and inhibitory activity show a positive correlation. Based on the correlation curves in Fig. 3b, the IC50 is 4.358 mg/mL.

      Figure 3. 

      (a) Relationship between ACE inhibitory peptide concentration and inhibitory activity of seabuckthorn seed meal. (b) Kinetic double reciprocal diagram of seabuckthorn seed meal polypeptide inhibiting ACE. (c) The ACE inhibition rate of seabuckthorn seed meal peptides treated at different temperatures. (d) The ACE inhibition rate of seabuckthorn seed meal peptides treated at different pH. Different letters represent significant differences at p < 0.05.

    • Lineweaver-Burk plots were used to analyze the kinetic mechanism of ACE inhibition of seabuckthorn seed meal peptides. As shown in Fig. 3a, the Lineweaver-Burk line of seabuckthorn seed meal peptide intersects 1/[S], indicating that the inhibition type of ACE by seabuckthorn seed meal peptide is non-competitive. This proved that the seabuckthorn seed meal polypeptide does not compete with the substrate and can bind to the ACE-HHL complex or sites other than the ACE active site, changing the spatial formulation of ACE and reducing the activity[40]. The ACE inhibition rate of the polypeptides from seabuckthorn seed meal was positively correlated with the concentration, similar to the inhibition mode of the ACE inhibitory peptide derived from tilapia skin gelatin[41]. The tetrapeptide FRVM from the algae[18], and all of them were non-competitive.

    • Figure 3c & d shows the results of the inhibition rate determined after treatment of peptide solution < 3 kDa at different temperatures and pH for 2 h. There was no significant change in the inhibition rate of ACE by the polypeptides of seabuckthorn seed meal, which indicated that peptides < 3 kDa had good thermal stability and pH stability.

      The ACE inhibition rate of 1% (w/v) peptide solution was 67.46% ± 3.83%. The undigested peptide solution was digested by pepsin and trypsin, and its structure was destroyed. In general, the ACE inhibitory peptide of seabuckthorn seed meal peptides still has an excellent inhibitory ability after digestion. This suggests that the performance of the peptides is stable after oral administration[29]. Studies have shown that some ACE-inhibitory peptides do not achieve the desired effect after they enter the body because they are broken down into peptides with low ACE-inhibitory activity in the stomach[42,43].

    • Molecular simulation docking was performed on ten selected peptides with ACE inhibitory activity, and the docking results are shown in Fig. 4. According to Natesh's team[44], the active sites in ACE can be divided into three pockets, namely S1, S2, and S1′. S1 contains Glu384 and Tyr523. S2 contains His353, Ala354, Cys511, His513 and Tyr520. S1′ contains Gln162, Asp377, and a triplex of catalytic sites for His383, His387, Glu411, and Zn2+.

      Figure 4. 

      Molecular docking results of peptides and ACE (1−10 docking results of 10 peptides in Table 2). Blue is peptide; Purple is ACE; Green is amino acid; Yellow is the bond created by the interaction.

      Using simulated docking, it was found that ten peptides interact with ACE at different sites and form different numbers of hydrogen bonds with ACE. Only the fifth peptide and ACE interact in chain-to-chain, and no bonds are formed at the atomic level. The binding ability of inhibitory peptides and ACE is related to the number and length of hydrogen bonds they form. In the results of this simulation, peptide 3 forms many hydrogen bonds with ACE, including Arg209, Glu202, Gln195, and Lys478, to form 12 hydrogen bonds, six of which were formed with Arg209, followed by peptides 4 and 8. The binding sites of peptide 4 are Gln231, Pro227, Glu230, Glu234, Gln466, and Lys491. Although the binding sites are not located at the active center of the ACE, they are all located near Zn2+. Peptides 1 and 2 form the fewest hydrogen bonds (only three), and none of them are in the ACE active site, but they are still close to the active pocket. In addition to hydrogen bonding, interactions between peptide chains are also crucial in maintaining the stability of the complexes they form.

    • Over the past decade, there has been a growing interest in the extraction of bioactive peptides from food. There is a trend towards the screening of bioactive peptides for use as drug substitutes in the treatment of hypertension[6]. A significant number of papers have investigated the structural characterization, bioavailability, functional effects, and inhibitory mechanisms of peptides[43,4547]. A significant number of studies have employed molecular docking, bioinformatics technology, and biological protein databases to analyze the relationship between the structure and biological activity of ACE-inhibitory peptides and to elucidate the inhibitory mechanism of ACE-inhibitory peptides[48]. According to existing literature, for ACE-inhibitory peptides, peptides with smaller molecular weights have more potent biological activity than peptides with larger molecular weights[49,50]. To enhance the biological activity of the protein hydrolysate, it was subjected to a series of separation and purification processes, with the aim of aligning the final product with the specific requirements of the target market. This involved the utilization of membrane separation technology, which allowed for the separation of peptides according to their characteristics. Ultrafiltration technology has been widely used in the production of proteins and polypeptides in factories, but the size of the separation molecular weight is negatively correlated with the cost of the factory; that is, the smaller the molecular weight, the more the cost of the factory, so the factory generally chooses to use 3 kDa ultrafiltration membrane for production. Since this study will be applied to factory production, peptides < 3 kDa were selected for study.

      The present study focuses on the characterization of polypeptides from the seed meal of seabuckthorn and their inhibitory activity and mechanism against ACE. Infrared spectroscopic scans, X-ray diffraction, and Quadrupole-TOF LC-MS/MS System have been used mainly for secondary and primary structure studies. The molecular weight of some active peptides identified in this study was higher than that of peptides obtained by other scholars, which may be because, for the practicality of the factory, too many separation and purification steps were not performed, and a specific peptide was not locked before identification, but the ultrafiltration samples were directly identified. In addition, the methods and databases used to identify ACE-inhibitory peptides may also lead to discrepancies and deficiencies in the results. Enzymatic products may contain short peptides not listed in the ACE inhibitor peptide database. Other reasons may be the difference in enzymes used. The enzymatic hydrolysis of food-grade enzyme preparations is weaker than that of chemical grade. Although the molecular weight of the identified peptides is slightly higher than that of other scholars, the results of previous specific research on the overall activity of ACE inhibitory peptides have shown better and can be applied in practical production.

      Molecular simulation docking technology is a commonly used method to study the active mechanism of active peptides. This technology can interact with small molecules and proteins through specific algorithms and continuously optimize information such as ligand positions, amino acid side chains, and bond angles. By obtaining the binding energy of each binding mode, researchers could quickly screen out peptides with better activity based on the binding energy. This approach has extensively promoted the development of active peptide research. Li's team[48] extracted RGLSK from Pixian bean sauce, which showed vigorous ACE inhibitory activity, and Ma's team[51] extracted EYFR and LPGP from the hydrolysate of Channa striatus, which may have ACE inhibitory function. Wei's team[52] extracted seven ACE inhibitory peptides from distillers' grains, and Lu's team[53] extracted four ACE inhibitory peptides from black tea, including QTDEYGNPPR, AGFAGDDAPR, IQDKEGIPPDQQR, and SIDELR, and understood their inhibitory mechanism through molecular simulation docking technology.

      This experiment uses food-grade enzymes for enzymatic hydrolysis, which avoids the distinction between chemical enzyme preparation and industrial enzyme preparation, making the experimental results more relevant to actual production and better applicable to industrial production. In this experiment, the selected peptide was not purified and synthesized, which made the ACE inhibitory peptide obtained had a higher IC50 than the peptide obtained in previous experiments, but we believe that this is in line with the needs of practical production. Moreover, the seabuckthorn seed meal peptide prepared in this study has only been tested for in vitro activity. The inhibitory effect in vivo has yet to be discovered, and further in-depth research is needed.

      In this experiment, seabuckthorn seed meal protein was used as raw material, food-grade enzyme preparation was used for enzymatic hydrolysis, the yield of peptide was 24.29%, and the structure of the obtained peptide solution was characterized and the effect of ACE inhibition activity was studied. The peptide solution was ultrafiltrated, and the peptide fragment < 3 kDa was selected for structural characterization. The structure of the peptide contained in the peptide solution was mainly β-fold and β-turn structure, and it was an amorphous structure. This makes the peptide more stable and will not change in actual production. Ten peptides with ACE inhibitory activity were screened by LC-MS/MS analysis, and compared with NCBI and Uniprot databases. Molecular docking showed the conformational relationship between each peptide and ACE. The experimental analysis showed that the inhibition mode of ACE by seabuckthorn seed meal protein peptide was non-competitive. No significant effect of the inhibitory activity of the peptide occurred at different temperatures and pH. In conclusion, polypeptides from seabuckthorn seed meal showed good inhibitory stability against ACE and could be a potential drug source for the treatment of hypertension.

    • The authors confirm contribution to the paper as follows: project administration: Peng Q; formal analysis, data curation: Zheng Y, Wang D; resources, writing - review & editing: Peng Q, Yuen M, Yuen T, Yuen H; funding acquisition: Peng Q, Yuen T; validation: Zheng Y, Wang D, Yuen H; visualization: Zhou Y, Wang D; investigation: Wang D, Zhou Y, Yuen M, Yuen T; methodology: Zheng Y; writing - original draft: Zheng Y, Wang D, Zhou Y. All authors reviewed the results and approved the final version of the manuscript.

    • The datasets generated during and/or analyzed during the current study are available from the corresponding author on reasonable request.

      • This research was financially supported by the Science and Technology Project of Xining (Grant No. 2022-Y-12) and Northwest A&F University College Students' Innovation and Entrepreneurship Training Programme (Grant No. 202410712287). The authors would also like to thank the instrument shared platform of College of Food Science & Engineering of Northwest A&F University, for the assistance in High Performance Liquid Chromatography (HPLC)/Fourier transform infrared spectrometer.

      • The authors declare that they have no conflict of interest.

      • Copyright: © 2024 by the author(s). Published by Maximum Academic Press on behalf of China Agricultural University, Zhejiang University and Shenyang Agricultural University. This article is an open access article distributed under Creative Commons Attribution License (CC BY 4.0), visit https://creativecommons.org/licenses/by/4.0/.
    Figure (4)  Table (4) References (53)
  • About this article
    Cite this article
    Zheng Y, Wang D, Zhou Y, Yuen M, Yuen T, et al. 2024. Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal. Food Innovation and Advances 3(3): 295−304 doi: 10.48130/fia-0024-0029
    Zheng Y, Wang D, Zhou Y, Yuen M, Yuen T, et al. 2024. Characterization and angiotensin-converting enzyme inhibitory activity of peptides of seabuckthorn (Hippophae rhamnoides L.) seed meal. Food Innovation and Advances 3(3): 295−304 doi: 10.48130/fia-0024-0029

Catalog

    /

    DownLoad:  Full-Size Img  PowerPoint
    Return
    Return